Recombinant Human cereblon(CRBN)

Art.No: BES23919R

specifications: 1mg

Sequence Information

Species: Human                             Gene lD: 51185

Swiss Prot: Q96SW2                          Synonyms: AD-006

Residues: Met1-Leu442

MAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDODSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCOVIPVLPOVMMILIPGOTLPLQLFHPQEVSMVRNLIOKDRTFAVLAYSNVOEREAOFGTTAEIYAYREEODFGIEIVKVKAIGRORFKVLELRTOSDGIOOAKVOILPECVLPSTMSAVOLESLNKCOIFPSKPVSREDOCSYKWNOKYOKRKFHCANLTSWPRWLYSLYDAETLMDRIKKOLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIOLLKIGSAIORLRCELDIMNKCTSLCCKOCOETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNINLIGRPSTEHSWEPGYAWTVAOCKICASHIGWKETATKKDMSPOKEWGLTRSALLPTIPDTEDEISPDKVILCL

Product Information

Source: Prokaryotic expression.

Host: E. coli

Tags: N-terminal His-Tag

Subcellular Location: Secreted.

Purity: >90%

Traits: Freeze-dried powder

Buffer formulation: PBS(PH7.4)),containing 5% Trehalose.

Original Concentration: 400ug/mL

Applications: Positive Control; Immunogen; SDS-PAGE; WB.

(May be suitable for use in other assays to be determined by the end user.)

Predicted isoelectric point: 5.3

Predicted Molecular Mass: 54kDa

Accurate Molecular Mass: 54kDa as determined by SDS-PAGE reducing conditions

[ USAGE ]

Reconstitute in PBS (pH7.4) to a concentration of 0.1-0.5 mg/mL. Do not vortex.

[ STORAGE AND STABILITY ]

Storage: Avoid repeated freeze/thaw cycles.

Store at 2-8°℃ for one month.

Aliquot and store at -80'C for 12 months.

Stability Test: The thermal stability is described by the loss rate. The loss rate was

determined by accelerated thermal degradation test, that is, incubate the protein at

37°C for 48h, and no obvious degradation and precipitation were observed. The

loss rate is less than 5% within the expiration date under appropriate storage

condition.

[IDENTIFICATION ]

Figure .SDS.PAGE

[IMPORTANT NOTE ]

The kit is designed for in vitro and research use only, we will not be responsible for any

issue if the kit was used in clinical diagnostic or any other procedures.